SCOP 1.75: Domain d2qwsa1: 2qws A:3-125

Lineage for d2qwsa1 (2qws A:3-125)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (7 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.1: PYP-like [55786] (2 proteins)

6. Protein Photoactive yellow protein, PYP [55787] (1 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [55788] (43 PDB entries)
   Uniprot P16113

8. Domain d2qwsa1: 2qws A:3-125 [151438]
   automatically matched to d1nwza_
   complexed with hc4

Details for d2qwsa1

PDB Entry: 2qws, 2.5 Å

PDB Description: neutron and x-ray structural studies of short hydrogen bonds in photoactive yellow protein (pyp)

PDB Compounds: (A:) Photoactive yellow protein

SCOP Domain Sequences for d2qwsa1:

Sequence; same for both SEQRES and ATOM records:

>d2qwsa1 d.110.3.1 (A:3-125) Photoactive yellow protein, PYP {Ectothiorhodospira halophila [TaxId: 1053]}
hvafgsedientlakmddgqldglafgaiqldgdgnilqynaaegditgrdpkqvigknf
fkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfv
krv

Timeline for d2qwsa1:

• d2qwsa1 is new in SCOP 1.75
  
• d2qwsa1 is called d2qwsa_ in SCOPe 2.01
  
• d2qwsa1 appears in the current release, SCOPe 2.08, called d2qwsa_