Lineage for d2qwpa1 (2qwp A:4-188)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372597Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 1372598Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)
  8. 1372619Domain d2qwpa1: 2qwp A:4-188 [151432]
    Other proteins in same PDB: d2qwpb_
    automatically matched to d1atra1
    complexed with acy, adp, gol, mg, na, po4

Details for d2qwpa1

PDB Entry: 2qwp (more details), 1.75 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-394aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi form #2
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d2qwpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qwpa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
gpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmv
ltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlciineptaaaiay
gldkk

SCOPe Domain Coordinates for d2qwpa1:

Click to download the PDB-style file with coordinates for d2qwpa1.
(The format of our PDB-style files is described here.)

Timeline for d2qwpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qwpa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2qwpb_