SCOPe 2.06: Domain d2qwnb_: 2qwn B:

Lineage for d2qwnb_ (2qwn B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.3: Chaperone J-domain [46565] (2 families)

5. Family a.2.3.1: Chaperone J-domain [46566] (7 proteins)
   Pfam PF00226

6. Protein Auxilin J-domain [88969] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88970] (7 PDB entries)

8. Domain d2qwnb_: 2qwn B: [151429]
   Other proteins in same PDB: d2qwna1, d2qwna2
   automated match to d2qwnb_
   complexed with adp, mg, na, po4

Details for d2qwnb_

PDB Entry: 2qwn, 2.4 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state

PDB Compounds: (B:) Putative tyrosine-protein phosphatase auxilin

SCOPe Domain Sequences for d2qwnb_:

Sequence; same for both SEQRES and ATOM records:

>d2qwnb_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}
mdpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavl
vvhpckatgqpyeqyakmifmelndawsefenqg

Timeline for d2qwnb_:

• d2qwnb_ first appeared in SCOP 1.75, called d2qwnb1
  
• d2qwnb_ appears in SCOPe 2.05
  
• d2qwnb_ appears in SCOPe 2.07
  
• d2qwnb_ appears in the current release, SCOPe 2.08