SCOPe 2.06: Domain d2qwna1: 2qwn A:3-188

Lineage for d2qwna1 (2qwn A:3-188)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (35 PDB entries)

8. Domain d2qwna1: 2qwn A:3-188 [151427]
   Other proteins in same PDB: d2qwnb_
   automated match to d1atra1
   complexed with adp, mg, na, po4

Details for d2qwna1

PDB Entry: 2qwn, 2.4 Å

PDB Description: crystal structure of disulfide-bond-crosslinked complex of bovine hsc70 (1-386aa)r171c and bovine auxilin (810-910aa)d876c in the adp*pi state

PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d2qwna1:

Sequence; same for both SEQRES and ATOM records:

>d2qwna1 c.55.1.1 (A:3-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]}
kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlciineptaaaia
ygldkk

Timeline for d2qwna1:

• d2qwna1 first appeared in SCOP 1.75
  
• d2qwna1 appears in SCOPe 2.05
  
• d2qwna1 appears in SCOPe 2.07
  
• d2qwna1 appears in the current release, SCOPe 2.08