SCOP 1.73: Domain d108ma_: 108m A:

Lineage for d108ma_ (108m A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d108ma_: 108m A: [15142]
   complexed with hem, nbn, so4; mutant

Details for d108ma_

PDB Entry: 108m, 2.67 Å

PDB Description: sperm whale myoglobin v68f n-butyl isocyanide at ph 7.0

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d108ma_:

Sequence; same for both SEQRES and ATOM records:

>d108ma_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d108ma_:

• d108ma_ first appeared (with stable ids) in SCOP 1.55, called d108m__
  
• d108ma_ was called d108m__ in SCOP 1.71
  
• d108ma_ appears in SCOP 1.75
  
• d108ma_ appears in the current release, SCOPe 2.08