Lineage for d2quea_ (2que A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925252Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 925253Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 925258Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 925596Protein automated matches [190139] (19 species)
    not a true protein
  7. 925628Species Daboia russellii [TaxId:97228] [186865] (26 PDB entries)
  8. 925646Domain d2quea_: 2que A: [151368]
    automated match to d1tgma_
    complexed with ajm, ann

Details for d2quea_

PDB Entry: 2que (more details), 2.25 Å

PDB Description: Saturation of substrate-binding site using two natural ligands: Crystal structure of a ternary complex of phospholipase A2 with anisic acid and ajmaline at 2.25 A resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d2quea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2quea_ a.133.1.2 (A:) automated matches {Daboia russellii [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d2quea_:

Click to download the PDB-style file with coordinates for d2quea_.
(The format of our PDB-style files is described here.)

Timeline for d2quea_: