SCOPe 2.03: Domain d2qtva5: 2qtv A:45-119

Lineage for d2qtva5 (2qtv A:45-119)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.10: Zn-finger domain of Sec23/24 [82919] (1 family)

5. Family g.41.10.1: Zn-finger domain of Sec23/24 [82920] (2 proteins)

6. Protein Sec23 [82921] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82922] (3 PDB entries)

8. Domain d2qtva5: 2qtv A:45-119 [151361]
   Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva4, d2qtvb_
   automatically matched to d1m2oa5
   complexed with gnp, mg, zn

Details for d2qtva5

PDB Entry: 2qtv, 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31

PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva5:

Sequence; same for both SEQRES and ATOM records:

>d2qtva5 g.41.10.1 (A:45-119) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
elnvapynpvvcsgphcksilnpycvidprnsswscpicnsrnhlppqytnlsqenmple
lqsttieyitnkpvt

Timeline for d2qtva5:

• d2qtva5 first appeared in SCOP 1.75
  
• d2qtva5 appears in SCOPe 2.02
  
• d2qtva5 appears in SCOPe 2.04
  
• d2qtva5 appears in the current release, SCOPe 2.08