Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) |
Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins) |
Protein Sec23 [82756] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (3 PDB entries) |
Domain d2qtva4: 2qtv A:627-768 [151360] Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva5, d2qtvb_ automatically matched to d1m2va4 complexed with gnp, mg, zn |
PDB Entry: 2qtv (more details), 2.5 Å
SCOPe Domain Sequences for d2qtva4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qtva4 d.109.2.1 (A:627-768) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl tddvslqnfmthlqqvavsgqa
Timeline for d2qtva4:
View in 3D Domains from same chain: (mouse over for more information) d2qtva1, d2qtva2, d2qtva3, d2qtva5 |