SCOPe 2.08: Domain d2qtva4: 2qtv A:627-768

Lineage for d2qtva4 (2qtv A:627-768)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family)

5. Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)

6. Protein Sec23 [82756] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82757] (3 PDB entries)

8. Domain d2qtva4: 2qtv A:627-768 [151360]
   Other proteins in same PDB: d2qtva1, d2qtva2, d2qtva3, d2qtva5, d2qtvb_
   automatically matched to d1m2va4
   complexed with gnp, mg, zn

Details for d2qtva4

PDB Entry: 2qtv, 2.5 Å

PDB Description: structure of sec23-sar1 complexed with the active fragment of sec31

PDB Compounds: (A:) protein transport protein SEC23

SCOPe Domain Sequences for d2qtva4:

Sequence; same for both SEQRES and ATOM records:

>d2qtva4 d.109.2.1 (A:627-768) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptltsfsmeddpqpvlldsisvkpntillldtfffiliyhgeqiaqwrkagyqddpqyad
fkalleepkleaaellvdrfplprfidteaggsqarfllsklnpsdnyqdmarggstivl
tddvslqnfmthlqqvavsgqa

Timeline for d2qtva4:

• d2qtva4 first appeared in SCOP 1.75
  
• d2qtva4 appears in SCOPe 2.07