Lineage for d2qtcb3 (2qtc B:701-886)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1603362Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1603363Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 1603364Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 1603365Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 1603366Species Escherichia coli [TaxId:562] [75240] (8 PDB entries)
  8. 1603370Domain d2qtcb3: 2qtc B:701-886 [151348]
    Other proteins in same PDB: d2qtca1, d2qtca2, d2qtcb1, d2qtcb2
    automated match to d2ieaa3
    complexed with mg, tdk; mutant

Details for d2qtcb3

PDB Entry: 2qtc (more details), 1.77 Å

PDB Description: e. coli pyruvate dehydrogenase e1 component e401k mutant with phosphonolactylthiamin diphosphate
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d2qtcb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qtcb3 c.48.1.1 (B:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOPe Domain Coordinates for d2qtcb3:

Click to download the PDB-style file with coordinates for d2qtcb3.
(The format of our PDB-style files is described here.)

Timeline for d2qtcb3: