Lineage for d2qspb1 (2qsp B:1-145)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759009Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 759043Species Cow (Bos taurus) [TaxId:9913] [46506] (8 PDB entries)
  8. 759046Domain d2qspb1: 2qsp B:1-145 [151319]
    Other proteins in same PDB: d2qspa1, d2qspc1
    automatically matched to d1fsxb_
    complexed with hem

Details for d2qspb1

PDB Entry: 2qsp (more details), 1.85 Å

PDB Description: Bovine Hemoglobin at pH 5.7
PDB Compounds: (B:) Hemoglobin subunit beta

SCOP Domain Sequences for d2qspb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qspb1 a.1.1.2 (B:1-145) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOP Domain Coordinates for d2qspb1:

Click to download the PDB-style file with coordinates for d2qspb1.
(The format of our PDB-style files is described here.)

Timeline for d2qspb1: