SCOPe 2.08: Domain d2qrza_: 2qrz A:

Lineage for d2qrza_ (2qrz A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)

8. Domain d2qrza_: 2qrz A: [151309]
   automated match to d1an0a_
   complexed with gcp, mg, so4

Details for d2qrza_

PDB Entry: 2qrz, 2.4 Å

PDB Description: Cdc42 bound to GMP-PCP: Induced Fit by Effector is Required

PDB Compounds: (A:) Cell division control protein 42 homolog precursor

SCOPe Domain Sequences for d2qrza_:

Sequence; same for both SEQRES and ATOM records:

>d2qrza_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcv

Timeline for d2qrza_:

• d2qrza_ first appeared in SCOP 1.75, called d2qrza1
  
• d2qrza_ appears in SCOPe 2.07