SCOPe 2.08: Domain d2qrrb_: 2qrr B:

Lineage for d2qrrb_ (2qrr B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.13: NIL domain-like [160322] (2 proteins)
   Pfam PF09383

6. Protein Methionine import ATP-binding protein MetN [160323] (2 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [160324] (1 PDB entry)
   Uniprot Q87RS1 248-344

8. Domain d2qrrb_: 2qrr B: [151308]
   automated match to d2qrra1
   complexed with cl

Details for d2qrrb_

PDB Entry: 2qrr, 1.71 Å

PDB Description: crystal structure of the soluble domain of the abc transporter, atp- binding protein from vibrio parahaemolyticus

PDB Compounds: (B:) Methionine import ATP-binding protein metN

SCOPe Domain Sequences for d2qrrb_:

Sequence; same for both SEQRES and ATOM records:

>d2qrrb_ d.58.18.13 (B:) Methionine import ATP-binding protein MetN {Vibrio parahaemolyticus [TaxId: 670]}
lsipedyqarlqpnrvegsyplvrmeftgatvdaplmsqisrkynidvsilssdldyagg
vkfgmmvaelfgneqddsaaieylrennvkvevlgyvl

Timeline for d2qrrb_:

• d2qrrb_ first appeared in SCOP 1.75, called d2qrrb1
  
• d2qrrb_ appears in SCOPe 2.07