![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.33: Acylamino-acid-releasing enzyme, C-terminal donain [117711] (1 protein) closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497) closely related to the prolyl peptidase and DPP6 domains ((53496) and 82497) |
![]() | Protein Acylamino-acid-releasing enzyme, C-terminal donain [117712] (1 species) |
![]() | Species Aeropyrum pernix [TaxId:56636] [117713] (7 PDB entries) Uniprot Q9YBQ2 |
![]() | Domain d2qr5a2: 2qr5 A:322-581 [151279] Other proteins in same PDB: d2qr5a1, d2qr5b1 automatically matched to d1ve6a2 mutant |
PDB Entry: 2qr5 (more details), 2.2 Å
SCOP Domain Sequences for d2qr5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr5a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} lpedlrrsiagsrlvwvesfdgsrvptyvlesgraptpgptvvlvaggpfaedsdswdtf aaslaaagfhvvmpnyrgstgygeewrlkiigdpcggeledvsaaarwaresglaselyi mgysyggymtlcaltmkpglfkagvagasvvdweemyelsdaafrnfieqltggsreimr srspinhvdrikeplalihpqndsrtplkpllrlmgellargktfeahiipdaghaintm edavkillpavfflatqrer
Timeline for d2qr5a2: