Lineage for d2qr0q1 (2qr0 Q:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288752Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (35 PDB entries)
  8. 1288819Domain d2qr0q1: 2qr0 Q:1-107 [151260]
    Other proteins in same PDB: d2qr0a2, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g2, d2qr0h1, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w2, d2qr0x1, d2qr0x2
    automatically matched to d1g9ml1

Details for d2qr0q1

PDB Entry: 2qr0 (more details), 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs
PDB Compounds: (Q:) Fab-Fragment Light Chain

SCOPe Domain Sequences for d2qr0q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr0q1 b.1.1.1 (Q:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqysyyyypftfgqgtkveik

SCOPe Domain Coordinates for d2qr0q1:

Click to download the PDB-style file with coordinates for d2qr0q1.
(The format of our PDB-style files is described here.)

Timeline for d2qr0q1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qr0q2