| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), gamma-chain [TaxId:9606] [63651] (3 PDB entries) |
| Domain d2qr0h1: 2qr0 H:12-111 [151246] Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0h2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x2 automatically matched to d1hxma1 |
PDB Entry: 2qr0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qr0h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr0h1 b.1.1.1 (H:12-111) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]}
vqpggslrlscaasgfnfssssihwvrqapgkglewvayiypsysytsyadsvkgrftis
adtskntaylqmnslraedtavyycaryygtgamdywgqgtlvtv
Timeline for d2qr0h1:
View in 3DDomains from other chains: (mouse over for more information) d2qr0a1, d2qr0a2, d2qr0b1, d2qr0b2, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0f2, d2qr0g1, d2qr0g2, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0l2, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0n2, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0r2, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0t2, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x1, d2qr0x2 |