Lineage for d2qr0f2 (2qr0 F:114-216)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515187Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1515463Domain d2qr0f2: 2qr0 F:114-216 [151243]
    Other proteins in same PDB: d2qr0a1, d2qr0a2, d2qr0b1, d2qr0c1, d2qr0d1, d2qr0e1, d2qr0e2, d2qr0f1, d2qr0g1, d2qr0g2, d2qr0h1, d2qr0i1, d2qr0j1, d2qr0k1, d2qr0k2, d2qr0l1, d2qr0m1, d2qr0m2, d2qr0n1, d2qr0o1, d2qr0p1, d2qr0q1, d2qr0q2, d2qr0r1, d2qr0s1, d2qr0s2, d2qr0t1, d2qr0u1, d2qr0v1, d2qr0w1, d2qr0w2, d2qr0x1
    automatically matched to d1ngzb2

Details for d2qr0f2

PDB Entry: 2qr0 (more details), 3.5 Å

PDB Description: structure of vegf complexed to a fab containing tyr and ser in the cdrs
PDB Compounds: (F:) Fab-Fragment Heavy Chain

SCOPe Domain Sequences for d2qr0f2:

Sequence, based on SEQRES records: (download)

>d2qr0f2 b.1.1.2 (F:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2qr0f2 b.1.1.2 (F:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d2qr0f2:

Click to download the PDB-style file with coordinates for d2qr0f2.
(The format of our PDB-style files is described here.)

Timeline for d2qr0f2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qr0f1