SCOPe 2.07: Domain d2qqnh2: 2qqn H:114-216

Lineage for d2qqnh2 (2qqn H:114-216)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (184 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2qqnh2: 2qqn H:114-216 [151225]
   Other proteins in same PDB: d2qqna_, d2qqnh1, d2qqnl1, d2qqnl2
   automatically matched to d1aqkh2
   complexed with edo

Details for d2qqnh2

PDB Entry: 2qqn, 2.2 Å

PDB Description: neuropilin-1 b1 domain in complex with a vegf-blocking fab

PDB Compounds: (H:) antibody heavy chain

SCOPe Domain Sequences for d2qqnh2:

Sequence, based on SEQRES records:

>d2qqnh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records):

>d2qqnh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d2qqnh2:

• d2qqnh2 first appeared in SCOP 1.75
  
• d2qqnh2 appears in SCOPe 2.06
  
• d2qqnh2 does not appear in SCOPe 2.08