SCOP 1.75: Domain d2qqnh2: 2qqn H:114-216

Lineage for d2qqnh2 (2qqn H:114-216)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
   SQ NA # humanized antibody
   Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2qqnh2: 2qqn H:114-216 [151225]
   Other proteins in same PDB: d2qqna1, d2qqnh1
   automatically matched to d1aqkh2
   complexed with edo

Details for d2qqnh2

PDB Entry: 2qqn, 2.2 Å

PDB Description: neuropilin-1 b1 domain in complex with a vegf-blocking fab

PDB Compounds: (H:) antibody heavy chain

SCOP Domain Sequences for d2qqnh2:

Sequence, based on SEQRES records:

>d2qqnh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Sequence, based on observed residues (ATOM records):

>d2qqnh2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d2qqnh2:

• d2qqnh2 is new in SCOP 1.75
  
• d2qqnh2 appears in SCOPe 2.01
  
• d2qqnh2 last appears in SCOPe 2.07