Lineage for d2qqia2 (2qqi A:272-426)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530228Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins)
    automatically mapped to Pfam PF00754
  6. 1530244Protein C2 domain of factor VIII [49794] (1 species)
  7. 1530245Species Human (Homo sapiens) [TaxId:9606] [49795] (5 PDB entries)
  8. 1530248Domain d2qqia2: 2qqi A:272-426 [151219]
    automated match to d1sddb4
    complexed with gol

Details for d2qqia2

PDB Entry: 2qqi (more details), 1.8 Å

PDB Description: crystal structure of the b1b2 domains from human neuropilin-1
PDB Compounds: (A:) Neuropilin-1

SCOPe Domain Sequences for d2qqia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qqia2 b.18.1.2 (A:272-426) C2 domain of factor VIII {Human (Homo sapiens) [TaxId: 9606]}
mfkcmealgmesgeihsdqitassqystnwsaersrlnypengwtpgedsyrewiqvdlg
llrfvtavgtqgaisketkkkyyvktykidvssngedwitikegnkpvlfqgntnptdvv
vavfpkplitrfvrikpatwetgismrfevygcki

SCOPe Domain Coordinates for d2qqia2:

Click to download the PDB-style file with coordinates for d2qqia2.
(The format of our PDB-style files is described here.)

Timeline for d2qqia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qqia1