SCOP 1.75: Domain d2qpva1: 2qpv A:1-133

Lineage for d2qpva1 (2qpv A:1-133)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (10 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.8: Atu1531-like [160742] (2 proteins)
   Pfam PF10604; Polyketide cyclase/dehydrase and lipid transport

6. Protein Uncharacterized protein Atu1531 [160745] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [160746] (1 PDB entry)
   Uniprot Q7CZ16 1-133

8. Domain d2qpva1: 2qpv A:1-133 [151215]
   complexed with acy

Details for d2qpva1

PDB Entry: 2qpv, 2.35 Å

PDB Description: Crystal structure of uncharacterized protein Atu1531

PDB Compounds: (A:) Uncharacterized protein Atu1531

SCOP Domain Sequences for d2qpva1:

Sequence; same for both SEQRES and ATOM records:

>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]}
mpvmqsriihlsvekpwaevydfaanpgnmprwaaglaggleadgedwiakggplgevrv
nfaphnefgvidhvvtlpdglkvynalrvtpngsgtevsftllrlegmtdedfeqdasai
tadlemlksllea

Timeline for d2qpva1:

• d2qpva1 is new in SCOP 1.75
  
• d2qpva1 appears in SCOPe 2.01
  
• d2qpva1 appears in the current release, SCOPe 2.08