Class b: All beta proteins [48724] (174 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Plant alpha-amylase [51040] (2 species) single beta-sheet; probable result of a decay of the common-fold |
Species Barley (Hordeum vulgare), AMY1 isozyme [TaxId:4513] [89384] (8 PDB entries) |
Domain d2qpuc1: 2qpu C:348-404 [151213] Other proteins in same PDB: d2qpua2, d2qpub2, d2qpuc2 automatically matched to d1ht6a1 complexed with bgc, ca, edo, qps, qpu; mutant |
PDB Entry: 2qpu (more details), 1.7 Å
SCOPe Domain Sequences for d2qpuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpuc1 b.71.1.1 (C:348-404) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} itatsalkilmhegdayvaeidgkvvvkigprydvgavipagfvtsahgndyavwek
Timeline for d2qpuc1:
View in 3D Domains from other chains: (mouse over for more information) d2qpua1, d2qpua2, d2qpub1, d2qpub2 |