Lineage for d2qpec_ (2qpe C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698066Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 1698067Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (1 protein)
  6. 1698068Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 1698069Species Thermus thermophilus [TaxId:274] [81470] (24 PDB entries)
  8. 1698089Domain d2qpec_: 2qpe C: [151204]
    Other proteins in same PDB: d2qpea_, d2qpeb1, d2qpeb2
    automated match to d1xmec1
    complexed with cu1, cua, has, hem

Details for d2qpec_

PDB Entry: 2qpe (more details), 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d2qpec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpec_ f.23.9.1 (C:) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d2qpec_:

Click to download the PDB-style file with coordinates for d2qpec_.
(The format of our PDB-style files is described here.)

Timeline for d2qpec_: