Lineage for d2qpeb2 (2qpe B:3-36)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059011Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1059033Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1059034Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1059049Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)
  7. 1059050Species Thermus thermophilus [TaxId:274] [81459] (5 PDB entries)
    the "missing" first helix is complemented by the ba3 subunit IIa
  8. 1059053Domain d2qpeb2: 2qpe B:3-36 [151203]
    Other proteins in same PDB: d2qpea_, d2qpeb1, d2qpec1
    automatically matched to d1ehkb2
    complexed with cu1, cua, has, hem

Details for d2qpeb2

PDB Entry: 2qpe (more details), 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2qpeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpeb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dqhkahkailayekgwlafslamlfvfialiayt

SCOPe Domain Coordinates for d2qpeb2:

Click to download the PDB-style file with coordinates for d2qpeb2.
(The format of our PDB-style files is described here.)

Timeline for d2qpeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2qpeb1