SCOPe 2.03: Domain d2qpeb1: 2qpe B:37-168

Lineage for d2qpeb1 (2qpe B:37-168)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (25 PDB entries)

8. Domain d2qpeb1: 2qpe B:37-168 [151202]
   Other proteins in same PDB: d2qpea_, d2qpeb2, d2qpec_
   automatically matched to d2cuab_
   complexed with cu1, cua, has, hem

Details for d2qpeb1

PDB Entry: 2qpe, 2.9 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2qpeb1:

Sequence; same for both SEQRES and ATOM records:

>d2qpeb1 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke

Timeline for d2qpeb1:

• d2qpeb1 first appeared in SCOP 1.75
  
• d2qpeb1 appears in SCOPe 2.02
  
• d2qpeb1 appears in SCOPe 2.04
  
• d2qpeb1 appears in the current release, SCOPe 2.08