Lineage for d2qpdc1 (2qpd C:2-34)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630966Superfamily f.23.9: Bacterial ba3 type cytochrome c oxidase subunit IIa [81473] (1 family) (S)
    automatically mapped to Pfam PF08113
  5. 2630967Family f.23.9.1: Bacterial ba3 type cytochrome c oxidase subunit IIa [81472] (2 proteins)
  6. 2630968Protein Bacterial ba3 type cytochrome c oxidase subunit IIa [81471] (1 species)
    functionally important, corresponds to the first helix of the aa3 type subunit II absent in the ba3 type subunit II
  7. 2630969Species Thermus thermophilus [TaxId:274] [81470] (26 PDB entries)
  8. 2630995Domain d2qpdc1: 2qpd C:2-34 [151201]
    Other proteins in same PDB: d2qpdb1, d2qpdb2
    automatically matched to d1ehkc_
    complexed with cu1, cua, has, hem

Details for d2qpdc1

PDB Entry: 2qpd (more details), 3.25 Å

PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (C:) Cytochrome c oxidase polypeptide 2A

SCOPe Domain Sequences for d2qpdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qpdc1 f.23.9.1 (C:2-34) Bacterial ba3 type cytochrome c oxidase subunit IIa {Thermus thermophilus [TaxId: 274]}
eekpkgalavilvltltilvfwlgvyavffarg

SCOPe Domain Coordinates for d2qpdc1:

Click to download the PDB-style file with coordinates for d2qpdc1.
(The format of our PDB-style files is described here.)

Timeline for d2qpdc1: