SCOPe 2.05: Domain d2mgja_: 2mgj A:

Lineage for d2mgja_ (2mgj A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
   Uniprot P02185

8. Domain d2mgja_: 2mgj A: [15119]
   complexed with hem, so4; mutant

Details for d2mgja_

PDB Entry: 2mgj, 2 Å

PDB Description: high resolution crystal structures of five distal histidine mutants of sperm whale myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2mgja_:

Sequence; same for both SEQRES and ATOM records:

>d2mgja_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkvgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2mgja_:

• d2mgja_ first appeared (with stable ids) in SCOP 1.55, called d2mgj__
  
• d2mgja_ appears in SCOPe 2.04
  
• d2mgja_ appears in SCOPe 2.06
  
• d2mgja_ appears in the current release, SCOPe 2.08