Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) automatically mapped to Pfam PF00203 |
Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
Protein Ribosomal protein S19 [54572] (2 species) |
Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
Domain d2qp0s1: 2qp0 S:2-80 [151161] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0t1, d2qp0u1 protein/RNA complex; complexed with mg, nmy, scm protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp0s1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0s1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2qp0s1: