SCOPe 2.07: Domain d2qp0n1: 2qp0 N:1-100

Lineage for d2qp0n1 (2qp0 N:1-100)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.7: Ribosomal protein S14 [57752] (1 protein)

6. Protein Ribosomal protein S14 [57753] (2 species)

7. Species Escherichia coli [TaxId:562] [161162] (24 PDB entries)
   Uniprot P02370 1-100

8. Domain d2qp0n1: 2qp0 N:1-100 [151157]
   Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
   protein/RNA complex; complexed with mg, nmy, scm
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0n1

PDB Entry: 2qp0, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (N:) 30S ribosomal protein S14

SCOPe Domain Sequences for d2qp0n1:

Sequence, based on SEQRES records:

>d2qp0n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnasdedrwnavlklqtlprdsspsrqr
nrcrqtgrphgflrkfglsrikvreaamrgeipglkkasw

Sequence, based on observed residues (ATOM records):

>d2qp0n1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]}
akqsmkarevkrvaladkyfakraelkaiisdvnarwnavlklqtlprdsspsrqrnrcr
qtgrphgflrkfglsrikvreaamrgeipglkkasw

Timeline for d2qp0n1:

• d2qp0n1 first appeared in SCOP 1.75
  
• d2qp0n1 appears in SCOPe 2.06
  
• d2qp0n1 appears in the current release, SCOPe 2.08