![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
![]() | Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) ![]() contains a helix-two turns-helix (H2TH) motif |
![]() | Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
![]() | Protein Ribosomal protein S13 [46948] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [158360] (26 PDB entries) Uniprot P0A7S9 1-114 |
![]() | Domain d2qp0m1: 2qp0 M:1-113 [151156] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1 automatically matched to 2AVY M:1-114 protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOPe Domain Sequences for d2qp0m1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0m1 a.156.1.1 (M:1-113) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprk
Timeline for d2qp0m1: