![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Ribosomal protein S12 [50302] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [159087] (25 PDB entries) Uniprot P0A7S3 1-123 |
![]() | Domain d2qp0l1: 2qp0 L:1-123 [151155] Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1 automatically matched to 2AVY L:1-123 complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOP Domain Sequences for d2qp0l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0l1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]} atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr pka
Timeline for d2qp0l1: