Lineage for d2qp0j1 (2qp0 J:5-102)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196721Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2196722Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2196723Protein Ribosomal protein S10 [55001] (2 species)
  7. 2196724Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 2196730Domain d2qp0j1: 2qp0 J:5-102 [151153]
    Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
    protein/RNA complex; complexed with mg, nmy, scm
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0j1

PDB Entry: 2qp0 (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2qp0j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qp0j1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOPe Domain Coordinates for d2qp0j1:

Click to download the PDB-style file with coordinates for d2qp0j1.
(The format of our PDB-style files is described here.)

Timeline for d2qp0j1: