SCOPe 2.05: Domain d2qp0c2: 2qp0 C:106-206

Lineage for d2qp0c2 (2qp0 C:106-206)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d2qp0c2: 2qp0 C:106-206 [151145]
   Other proteins in same PDB: d2qp0b1, d2qp0c1, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1
   protein/RNA complex; complexed with mg, nmy, scm
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qp0c2

PDB Entry: 2qp0, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the second 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2qp0c2:

Sequence; same for both SEQRES and ATOM records:

>d2qp0c2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d2qp0c2:

• d2qp0c2 first appeared in SCOP 1.75
  
• d2qp0c2 appears in SCOPe 2.04
  
• d2qp0c2 appears in SCOPe 2.06
  
• d2qp0c2 appears in the current release, SCOPe 2.08