![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) ![]() fold elaborated with additional structures |
![]() | Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein) |
![]() | Protein Ribosomal protein S2 [52315] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [159491] (26 PDB entries) Uniprot P0A7V0 8-225 |
![]() | Domain d2qp0b1: 2qp0 B:8-225 [151143] Other proteins in same PDB: d2qp0c1, d2qp0c2, d2qp0d1, d2qp0e1, d2qp0e2, d2qp0f1, d2qp0g1, d2qp0h1, d2qp0i1, d2qp0j1, d2qp0k1, d2qp0l1, d2qp0m1, d2qp0n1, d2qp0p1, d2qp0q1, d2qp0r1, d2qp0s1, d2qp0t1, d2qp0u1 automatically matched to 2AVY B:8-225 complexed with mg, nmy, scm |
PDB Entry: 2qp0 (more details), 3.5 Å
SCOP Domain Sequences for d2qp0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qp0b1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]} mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd tnsdpdgvdfvipgnddairavtlylgavaatvregrs
Timeline for d2qp0b1: