SCOP 1.75: Domain d2qozc2: 2qoz C:61-124

Lineage for d2qozc2 (2qoz C:61-124)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Escherichia coli [TaxId:562] [159086] (27 PDB entries)
   Uniprot P60422 3-124

8. Domain d2qozc2: 2qoz C:61-124 [151116]
   Other proteins in same PDB: d2qoz01, d2qoz11, d2qoz31, d2qoz41, d2qozc1, d2qozd1, d2qoze1, d2qozf1, d2qozg1, d2qozg2, d2qozh1, d2qozh2, d2qozi1, d2qozi2, d2qozj1, d2qozk1, d2qozl1, d2qozm1, d2qozn1, d2qozo1, d2qozp1, d2qozq1, d2qozr1, d2qozs1, d2qozt1, d2qozu1, d2qozv1, d2qozw1, d2qozx1, d2qozy1, d2qozz1
   automatically matched to 2AW4 C:61-124
   complexed with mg, nmy, zn

Details for d2qozc2

PDB Entry: 2qoz, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOP Domain Sequences for d2qozc2:

Sequence; same for both SEQRES and ATOM records:

>d2qozc2 b.40.4.5 (C:61-124) N-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
yrivdfkrnkdgipavverleydpnrsanialvlykdgerryilapkglkagdqiqsgvd
aaik

Timeline for d2qozc2:

• d2qozc2 is new in SCOP 1.75
  
• d2qozc2 appears in SCOPe 2.01
  
• d2qozc2 appears in the current release, SCOPe 2.08