SCOPe 2.05: Domain d2qozc1: 2qoz C:125-269

Lineage for d2qozc1 (2qoz C:125-269)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
   Uniprot P60422 125-269

8. Domain d2qozc1: 2qoz C:125-269 [151115]
   Other proteins in same PDB: d2qoz01, d2qoz11, d2qoz31, d2qoz41, d2qozc2, d2qozd1, d2qoze1, d2qozf1, d2qozg1, d2qozg2, d2qozh1, d2qozh2, d2qozi1, d2qozi2, d2qozj1, d2qozk1, d2qozl1, d2qozm1, d2qozn1, d2qozo1, d2qozp1, d2qozq1, d2qozr1, d2qozs1, d2qozt1, d2qozu1, d2qozv1, d2qozw1, d2qozx1, d2qozy1, d2qozz1
   protein/RNA complex; complexed with mg, nmy, zn
   protein/RNA complex; complexed with mg, nmy, zn

Details for d2qozc1

PDB Entry: 2qoz, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 50S subunit of the first 70S ribosome, with neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2qozc1:

Sequence; same for both SEQRES and ATOM records:

>d2qozc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

Timeline for d2qozc1:

• d2qozc1 first appeared in SCOP 1.75
  
• d2qozc1 appears in SCOPe 2.04
  
• d2qozc1 appears in SCOPe 2.06
  
• d2qozc1 appears in the current release, SCOPe 2.08