SCOPe 2.04: Domain d2qoyu1: 2qoy U:3-53

Lineage for d2qoyu1 (2qoy U:3-53)

1. Root: SCOPe 2.04

2. Class j: Peptides [58231] (126 folds)

3. Fold j.122: Ribosomal protein S21p [161307] (1 superfamily)
   non-globular, mainly alpha-helical

4. Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family)

5. Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein)
   Pfam PF01165

6. Protein Ribosomal protein S21, RpsU [161310] (1 species)

7. Species Escherichia coli [TaxId:562] [161311] (24 PDB entries)
   Uniprot P68679 4-54

8. Domain d2qoyu1: 2qoy U:3-53 [151110]
   Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1
   automatically matched to 2AVY U:3-53
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyu1

PDB Entry: 2qoy, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (U:) 30S ribosomal protein S21

SCOPe Domain Sequences for d2qoyu1:

Sequence; same for both SEQRES and ATOM records:

>d2qoyu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]}
ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk

Timeline for d2qoyu1:

• d2qoyu1 first appeared in SCOP 1.75
  
• d2qoyu1 appears in SCOPe 2.03
  
• d2qoyu1 appears in SCOPe 2.05
  
• d2qoyu1 appears in the current release, SCOPe 2.08