Lineage for d2qoyt1 (2qoy T:2-86)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908369Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 908370Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 908371Protein Ribosomal protein S20 [46994] (2 species)
  7. 908372Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 908377Domain d2qoyt1: 2qoy T:2-86 [151109]
    Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyu1
    automatically matched to 2AVY T:2-86
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyt1

PDB Entry: 2qoy (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2qoyt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoyt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2qoyt1:

Click to download the PDB-style file with coordinates for d2qoyt1.
(The format of our PDB-style files is described here.)

Timeline for d2qoyt1: