![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.28: Ribosomal protein S19 [54569] (1 superfamily) alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123 |
![]() | Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) ![]() |
![]() | Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein) |
![]() | Protein Ribosomal protein S19 [54572] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160144] (26 PDB entries) Uniprot P0A7U3 2-80 |
![]() | Domain d2qoys1: 2qoy S:2-80 [151108] Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoyt1, d2qoyu1 automatically matched to 2AVY S:2-80 protein/RNA complex; complexed with mg, nmy, scm |
PDB Entry: 2qoy (more details), 3.5 Å
SCOPe Domain Sequences for d2qoys1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoys1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]} rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv tdemvghklgefaptrtyr
Timeline for d2qoys1: