Lineage for d2qoyr1 (2qoy R:19-73)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1080920Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1080921Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1080922Protein Ribosomal protein S18 [46913] (2 species)
  7. 1080923Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 1080928Domain d2qoyr1: 2qoy R:19-73 [151107]
    Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoys1, d2qoyt1, d2qoyu1
    automatically matched to 2AVY R:19-73
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyr1

PDB Entry: 2qoy (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qoyr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoyr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2qoyr1:

Click to download the PDB-style file with coordinates for d2qoyr1.
(The format of our PDB-style files is described here.)

Timeline for d2qoyr1: