Lineage for d2qoyq1 (2qoy Q:3-82)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789396Protein Ribosomal protein S17 [50304] (3 species)
  7. 1789399Species Escherichia coli [TaxId:562] [159088] (26 PDB entries)
    Uniprot P02373 3-82
  8. 1789404Domain d2qoyq1: 2qoy Q:3-82 [151106]
    Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
    protein/RNA complex; complexed with mg, nmy, scm
    protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoyq1

PDB Entry: 2qoy (more details), 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (Q:) 30S ribosomal protein S17

SCOPe Domain Sequences for d2qoyq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoyq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav

SCOPe Domain Coordinates for d2qoyq1:

Click to download the PDB-style file with coordinates for d2qoyq1.
(The format of our PDB-style files is described here.)

Timeline for d2qoyq1: