Class a: All alpha proteins [46456] (284 folds) |
Fold a.156: S13-like H2TH domain [81297] (1 superfamily) core: 3-4 helices |
Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) contains a helix-two turns-helix (H2TH) motif |
Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein) contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension |
Protein Ribosomal protein S13 [46948] (2 species) |
Species Escherichia coli [TaxId:562] [158360] (26 PDB entries) Uniprot P0A7S9 1-114 |
Domain d2qoym1: 2qoy M:1-114 [151103] Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1 automatically matched to 2AVY M:1-114 complexed with mg, nmy, scm |
PDB Entry: 2qoy (more details), 3.5 Å
SCOP Domain Sequences for d2qoym1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qoym1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]} ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp
Timeline for d2qoym1: