SCOPe 2.04: Domain d2qoye1: 2qoy E:78-158

Lineage for d2qoye1 (2qoy E:78-158)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)

7. Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
   Uniprot P0A7W1 78-158

8. Domain d2qoye1: 2qoy E:78-158 [151094]
   Other proteins in same PDB: d2qoyb1, d2qoyc1, d2qoyc2, d2qoyd1, d2qoye2, d2qoyf1, d2qoyg1, d2qoyh1, d2qoyi1, d2qoyj1, d2qoyk1, d2qoyl1, d2qoym1, d2qoyn1, d2qoyp1, d2qoyq1, d2qoyr1, d2qoys1, d2qoyt1, d2qoyu1
   automatically matched to 2AVY E:78-158
   protein/RNA complex; complexed with mg, nmy, scm

Details for d2qoye1

PDB Entry: 2qoy, 3.5 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin and neomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin and neomycin bound. The entire crystal structure contains two 70S ribosomes.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2qoye1:

Sequence; same for both SEQRES and ATOM records:

>d2qoye1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

Timeline for d2qoye1:

• d2qoye1 first appeared in SCOP 1.75
  
• d2qoye1 appears in SCOPe 2.03
  
• d2qoye1 appears in SCOPe 2.05
  
• d2qoye1 appears in the current release, SCOPe 2.08