SCOPe 2.08: Domain d1moda_: 1mod A:

Lineage for d1moda_ (1mod A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (318 PDB entries)
   Uniprot P02185

8. Domain d1moda_: 1mod A: [15107]
   complexed with hem, so4; mutant

Details for d1moda_

PDB Entry: 1mod, 2 Å

PDB Description: high-resolution crystal structures of distal histidine mutants of sperm whale myoglobin

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1moda_:

Sequence; same for both SEQRES and ATOM records:

>d1moda_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkktgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1moda_:

• d1moda_ first appeared (with stable ids) in SCOP 1.55, called d1mod__
  
• d1moda_ appears in SCOPe 2.07