Lineage for d1mlha_ (1mlh A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 759576Protein Myoglobin [46469] (9 species)
  7. 759674Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
    Uniprot P02185
  8. 759803Domain d1mlha_: 1mlh A: [15105]
    complexed with hem, mto, so4; mutant

Details for d1mlha_

PDB Entry: 1mlh (more details), 2 Å

PDB Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1mlha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlha_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOP Domain Coordinates for d1mlha_:

Click to download the PDB-style file with coordinates for d1mlha_.
(The format of our PDB-style files is described here.)

Timeline for d1mlha_: