SCOP 1.75: Domain d1mlfa_: 1mlf A:

Lineage for d1mlfa_ (1mlf A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (180 PDB entries)
   Uniprot P02185

8. Domain d1mlfa_: 1mlf A: [15103]
   complexed with cmo, hem, so4; mutant

Details for d1mlfa_

PDB Entry: 1mlf, 2 Å

PDB Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d1mlfa_:

Sequence; same for both SEQRES and ATOM records:

>d1mlfa_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d1mlfa_:

• d1mlfa_ first appeared (with stable ids) in SCOP 1.55, called d1mlf__
  
• d1mlfa_ appears in SCOP 1.73
  
• d1mlfa_ appears in SCOPe 2.01
  
• d1mlfa_ appears in the current release, SCOPe 2.08