| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins) barrel, closed; n=5, S=8 |
| Protein Ribosomal protein S17 [50304] (3 species) |
| Species Escherichia coli [TaxId:562] [159088] (26 PDB entries) Uniprot P02373 3-82 |
| Domain d2qouq1: 2qou Q:3-82 [151000] Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoul1, d2qoum1, d2qoun1, d2qoup1, d2qour1, d2qous1, d2qout1, d2qouu1 protein/RNA complex; complexed with mg, scm protein/RNA complex; complexed with mg, scm |
PDB Entry: 2qou (more details), 3.93 Å
SCOPe Domain Sequences for d2qouq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qouq1 b.40.4.5 (Q:3-82) Ribosomal protein S17 {Escherichia coli [TaxId: 562]}
kirtlqgrvvsdkmeksivvaierfvkhpiygkfikrttklhvhdennecgigdvveire
crplsktkswtlvrvvekav
Timeline for d2qouq1: