Lineage for d1ebca_ (1ebc A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (131 PDB entries) 
Domain d1ebca_: 1ebc A: [15100]
Details for d1ebca_
PDB Entry: 1ebc (more details), 1.8 Å
PDB Description: sperm whale met-myoglobin:cyanide complex
SCOP Domain Sequences for d1ebca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ebca_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon)}
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg
SCOP Domain Coordinates for d1ebca_:
Click to download the PDB-style file with coordinates for d1ebca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ebca_:
- d1ebca_ appears in SCOP 1.57
- d1ebca_ appears in the current release, SCOPe 2.08
View in 3D