Lineage for d2qoul1 (2qou L:1-123)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399564Protein Ribosomal protein S12 [50302] (2 species)
  7. 2399565Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 2399584Domain d2qoul1: 2qou L:1-123 [150996]
    Other proteins in same PDB: d2qoub1, d2qouc1, d2qouc2, d2qoud1, d2qoue1, d2qoue2, d2qouf1, d2qoug1, d2qouh1, d2qoui1, d2qouj1, d2qouk1, d2qoum1, d2qoun1, d2qoup1, d2qouq1, d2qour1, d2qous1, d2qout1, d2qouu1
    protein/RNA complex; complexed with mg, scm
    protein/RNA complex; complexed with mg, scm

Details for d2qoul1

PDB Entry: 2qou (more details), 3.93 Å

PDB Description: Crystal structure of the bacterial ribosome from Escherichia coli in complex with spectinomycin. This file contains the 30S subunit of the first 70S ribosome, with spectinomycin bound. The entire crystal structure contains two 70S ribosomes.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2qoul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qoul1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOPe Domain Coordinates for d2qoul1:

Click to download the PDB-style file with coordinates for d2qoul1.
(The format of our PDB-style files is described here.)

Timeline for d2qoul1: