Lineage for d2qnhs1 (2qnh s:19-88)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260595Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 1260596Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 1260597Protein Ribosomal protein S18 [46913] (2 species)
  7. 1260623Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 1260663Domain d2qnhs1: 2qnh s:19-88 [150942]
    Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhk1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnht1, d2qnhu1, d2qnhv1
    automatically matched to d2j00r1

Details for d2qnhs1

PDB Entry: 2qnh (more details), 3.83 Å

PDB Description: Interactions and Dynamics of the Shine-Dalgarno Helix in the 70S Ribosome. This file, 2QNH, contains the 30S ribosome subunit, two TRNA, and MRNA molecules. 50S ribosome subunit is in the file 1VSP.
PDB Compounds: (s:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2qnhs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qnhs1 a.4.8.1 (s:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2qnhs1:

Click to download the PDB-style file with coordinates for d2qnhs1.
(The format of our PDB-style files is described here.)

Timeline for d2qnhs1: