Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) automatically mapped to Pfam PF00338 |
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
Protein Ribosomal protein S10 [55001] (2 species) |
Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
Domain d2qnhk1: 2qnh k:3-100 [150934] Other proteins in same PDB: d2qnhc1, d2qnhe1, d2qnhf1, d2qnhg1, d2qnhh1, d2qnhi1, d2qnhj1, d2qnhl1, d2qnhm1, d2qnhn1, d2qnho1, d2qnhp1, d2qnhq1, d2qnhr1, d2qnhs1, d2qnht1, d2qnhu1, d2qnhv1 |
PDB Entry: 2qnh (more details), 3.83 Å
SCOPe Domain Sequences for d2qnhk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qnhk1 d.58.15.1 (k:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d2qnhk1: